SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|152807|gm1.4798_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|152807|gm1.4798_g
Domain Number 1 Region: 21-249
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 6.02e-61
Family Osmotin, thaumatin-like protein 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|152807|gm1.4798_g
Sequence length 249
Sequence
MMKTAIVAASLALASGAAARSITVTNKCSYTVWPGLYTGSGDAPAQATGWEADSGNTVTF
DVPDNWTAGRIWGRRECDFSTNPGPNSCVDGGCNGGLLCTDPGVPPASLAEFTLNANNMD
YYDVSLVDGFNIPMAIDNTAGCSQASCPVDLNPNCPSDIAGPTDSSGAVVGCKSACYANL
DGNQADSANCCSGSHNTAATCPPSGVAHYDYFKSSCPNSYAYAYDESSGTALWTCAYSAS
TDYTVTFCP
Download sequence
Identical sequences XP_007767762.1.51617 jgi|Conpu1|152807|gm1.4798_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]