SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|152848|gm1.4839_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|152848|gm1.4839_g
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00706
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|152848|gm1.4839_g
Sequence length 252
Sequence
MSPLLTISPRAPPASYASLPSTYPHPSHFTPAPSTPHTLPTPHPRVIPATPGPAPTPPAH
PVAHPHYDIPGAPRHTARTPPSPYTVSQNTVLPYALLGIFGGLAVLAIVYFGCRTPARRS
AAPLSHGHGGEGAEEFEHKVTLKGLATPELCRDEAAESAAQETKAHPLAFWTRWTARRSG
AAPGRDSDANRQVDSSFSDRDEKFSMSSGFSTPEPVVLPDFPKPVHHSETLSSLSHNTYA
YWAAPLPGNERR
Download sequence
Identical sequences jgi|Conpu1|152848|gm1.4839_g XP_007767798.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]