SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|152993|gm1.4984_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|152993|gm1.4984_g
Domain Number - Region: 465-530
Classification Level Classification E-value
Superfamily alpha/beta knot 0.00959
Family tRNA(m1G37)-methyltransferase TrmD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|152993|gm1.4984_g
Sequence length 592
Sequence
MSSVRIKKVPSGYGRLNSDDRPYPNSFSHRSSTSWIQNPFSSTPRTSSTSSSPRIPPSGQ
QRIIPENSPTRPPLATSPNNSRSSSRVAYHLRRNSSNRSDFLSHSQYPWAHDPFPTIFES
SEPHSQSGSQSQSRSRPAPSPRQPPRVTSPLGERTISLQGENAEIRMHTESGDRTPGLVE
SALSLPSNIQPEDIGLDELHHQEDIVEHLEVIDPQIATVSTLANAANAILIPPLSFYSRK
PVVVLSSPSRRKHKHDPEKGEQEGLEDMEDSLDRHVEDVLTKRAKFRRIMQGVWSFLKTP
MGMVTGIYGFLVVIWGTALVLILVKWINFHNLNTQTFWVEVCSQVECGLFTFTGIGLLPP
RIMDTYRITKIWWYQRKTRMLRAKAGLPQLYDVDDLPDPVYDPNYVHVLTDKEQKDLHHQ
QELFRESQTWYRAHGTETHRAFPISTALWICLFVDGNSFFQIILSNCLWSMDRYTRPDWT
TGTLIPATFLCGIVSGVLIWRGGKQTRRTEKVEQTLRAALAMEKAGKSVMPQQVADEVPG
SAKKEVDALANPSVAGSHTQSVTTFGKDKALMTPVIEEQMLIPPASDIKQKA
Download sequence
Identical sequences XP_007767894.1.51617 jgi|Conpu1|152993|gm1.4984_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]