SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|154374|gm1.6365_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|154374|gm1.6365_g
Domain Number 1 Region: 572-612,712-739
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000486
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 17-109
Classification Level Classification E-value
Superfamily PH domain-like 0.0000418
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.054
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|154374|gm1.6365_g
Domain Number - Region: 501-564
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0131
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|154374|gm1.6365_g
Sequence length 765
Sequence
MLASDDFVLTDYCYVFAKVYELIDFRWVDQGTAYFHGQFIEETNQAFLIAREEEEDERTI
LSTGSRYKDVYQRQQDTLIIWTEPDSVDYALNFQDAESCAEVWNFIIEVQYHINSSEAGG
FDSSSPNHDATMTAIILRTGHLPMPDHESGNVADIERSIKALARGHVKEKICDYIQRRLM
QTILILNDYGMYEHILDDDNFFAVVGMLEYDPEFPTHKTNYREFLHLTSRFHQPIPIPDE
SIQKKVHNTYRLQLLKDVVLACALDDSTFNNVLNSCIIFNQIDNVQNDPVFMREIASLYV
NAEVLGSVHGNGSAKPASKSVGASAAWASSSPDVTGSPTPAPRRRHHQTPIPGRAATATA
AAEAKTNVNTAEANLVKISTAREVLSAVLDHNLIGVRNHVLKQPDALRTLLEISVGNGPE
TLVAMGAKLLARPKDDPATEIDSPPPLLLQLYPLPYPVTKRTPLSRMIKFSSKLTSDEES
STLHVLKETRDGPRCVSGQASDSGNTIAKLQEENRLLKAQIQDMNANLSSFANQALDLED
VTSRIQEENRMLNAQIQDMNTRFSSSVIISRNDLDELVSCKVCTIKMQSPYLLPDCGHTL
CQSCLVNWFDIILAQFTASHPQYNPNDSHALNTHDRPLPTASSYATMPEEVVAFLRHPQI
MHHPVFALSMAARQFLDCHEQERGQQRHNQGGQGGNGNVGNNNGGAGPVQPRYTCPFCRT
ALHSRPVEEFFLKEVIDKLLNIAGEEEEPLTRSAALRNLFGTYIP
Download sequence
Identical sequences XP_007769305.1.51617 jgi|Conpu1|154374|gm1.6365_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]