SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|154475|gm1.6466_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|154475|gm1.6466_g
Domain Number - Region: 27-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0308
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|154475|gm1.6466_g
Sequence length 294
Sequence
MPSQHSQHRKSKAKKSKSSKTKNAHQRYGCPVDGCERVCRNASGLTQHFHSQHAGDIQDY
YHHQPAPPSPALPYSPPSRSPSPVDFSLEMLRSPSPPLASPSPQDTTSRNSPDIGEDPTV
GDAVNVGKLTRYFHKYLTGRKCDPDSNFLPPGSPPNSLTPNNVDDWHPFDSRLAFETANF
MFRQVQMSATYIDILCQLWALSLIKHGDDPPFRDHTHVYDTIDASKLGEIPWCCYIVRLH
SLEYAEVVFLPIAYVSGRLVNARRRRSLFPQSSCSTLGTEVSYNNIVFVFDTRD
Download sequence
Identical sequences jgi|Conpu1|154475|gm1.6466_g XP_007769395.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]