SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|154819|gm1.6810_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|154819|gm1.6810_g
Domain Number 1 Region: 275-539
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.77e-70
Family Tryptophan biosynthesis enzymes 0.000019
Further Details:      
 
Domain Number 2 Region: 35-225
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.29e-44
Family Class I glutamine amidotransferases (GAT) 0.0000196
Further Details:      
 
Domain Number 3 Region: 553-600,639-762,790-842
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.88e-42
Family Tryptophan biosynthesis enzymes 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|154819|gm1.6810_g
Sequence length 843
Sequence
MVSTSEMLANAPTPSGSSTNDVPTLPSHLLEPIDVFMIDNFDSFTWNLYQSLCLLGARVT
VVRNDFVPIQHAARLFAQMKIGRLIISPGPGNPKDDAGVCEEAIKYWAGKVPILGVCMGL
EVIVNTYGGDIAYAGEIMHGKLSPLTHDNRGIFRGLPQNFMVTRYHSLSAAHSTLPSCLA
PTAASDTGVIMGVRHRTLAIAAVQYHPESVVCEQGDALLRNFLKLNGGEWRNNPEYGVDA
GLPPFPVEVLAPSQAVNGSAGKLGTNGSAVAKAAPSILDRIYAQRAQDIVDAKLVPGHAP
AFLRAQIARGASPALIDFPARLAQSKPALMAEIKRASPSKGDIAPGADAGAQALAYALAG
AAVISVLTEPTWFKGTLADLRAARLAVSHLPNRPAILRKEFILDEYQIDEARLAGADTVL
LIVAMLPPHRLQALYDYSRSLGMEPLVEVNNAAEMKAACKLGAKVVGVNNRNLHSFDVDM
STTGRLAAHAPPGSILCALSGITGPADVRAFARQGVGAVLVGESLMRAKDTAAFIHELLG
TPKPPPTPAYKPLVKICGIRNKEEALAASQAGADMLGLVFAPKSKRVVSTQAALEISLAI
RTLRSSPEAPTPSPLIPRPKDSQNLPWFASHATRLAASKGRPLLVGVFQGQTLSEILDAV
EGAQLDMVQLHGREPPEWALHIPVPVVRAFHVETPSSPQPNGSAESNGASEKAKESGLRD
VSCPGLHKFVLLDAMRPDSTGLSGGGGKVLDLDLAQRIVRAGELAPRVVSFDASQASNGT
GQEEREGSALPIILAGGLTPENVGSVVEKVSPWAVDVSGGVENADGTGKDLEKVAAFVKA
VKG
Download sequence
Identical sequences XP_007769672.1.51617 jgi|Conpu1|154819|gm1.6810_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]