SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|155310|gm1.7301_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|155310|gm1.7301_g
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.03e-46
Family DJ-1/PfpI 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|155310|gm1.7301_g
Sequence length 252
Sequence
MPGRKSVLFVFTSASRVLNGDPTGWYLPEAAHPYYEVEPHHDIDFAATKGPNPPIDGNSV
VQLHYDEYQLRFLEDPVVQKKLRECKYLKDCKASDYDAIFYVGGRGPAIDLATDLDNIKL
CNEVRSFSLLAPSHRFADKIRAMVAQFWQSGKIVSAVCHGPCALVNVQNADGTSIYKGKK
YTGFSNVEEELIGGVTGLPFLLETKFQMAGGIYVKAEKPWLSNVVRDGKLITGQNPASAQ
AIGKALAAALAE
Download sequence
Identical sequences XP_007770240.1.51617 jgi|Conpu1|155310|gm1.7301_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]