SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|155460|gm1.7451_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|155460|gm1.7451_g
Domain Number - Region: 114-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0027
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 74-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0877
Family Classic zinc finger, C2H2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|155460|gm1.7451_g
Sequence length 500
Sequence
MVSNFADRVPSDRVIFACQNRLASGAYSPKSAFTLPKRSPYKHLSSRNYLASQITVCQNG
SPPQNGYLITNRRPHQRDVSPSKRWRCTACGNRYATKRNAEQHRCTDNHDHDHRFFCMSD
GCGKSYWHERSIGRHWETRHGPQTATQEGPRWEDRETDEAKGTRRRRIERVPACSVEEVQ
PELQQPGDSDNGHTTISSANRSDTAHPSTSNYGNCDPSAQLGHLNQGAYCAGTQYPESAP
YMPGAGSDHGYMVHGAPESTSAFGTTSYPSHADGSMGPYHPSGTASSYHDSSPESAPYMP
GAGSDHGYVVHGAPESTSAFGSTSYPSYANGSMNPYHPSGTANSYYDSSPESAPYMPGAG
SDHGYAPPESTSASETASYPSYANGSMGPYHPSGTASSYHDSSPESAPYMPGAGSDHGYV
VHGAPESTSAFGSTSYPSDASVEPVGGMAFPQTSEMANNNYHGSSSDGLAPTVAYEYNAP
ATAGYYEYAYTSSDGAFSGY
Download sequence
Identical sequences jgi|Conpu1|155460|gm1.7451_g XP_007770369.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]