SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|156131|gm1.8122_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|156131|gm1.8122_g
Domain Number - Region: 72-125
Classification Level Classification E-value
Superfamily PCD-like 0.00275
Family PCD-like 0.015
Further Details:      
 
Domain Number - Region: 95-140,175-285,368-415
Classification Level Classification E-value
Superfamily RNI-like 0.00981
Family 28-residue LRR 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|156131|gm1.8122_g
Sequence length 418
Sequence
MHRCLLILEVLSEICSHLSLQGEDSSLVSFARTCQALHGPALNQLWSCLTDFTPLVKCLP
EDVWRETAHGSKKVLSIKRSLRVADWERFRVYSTRVHHLCHSQNNLPSITQVPSSVFVAL
SSPTLAGPLFPNLRCLHWDDGSEDAFRFLNVAIGEKIHHVDIVLPHPIKARQLYESNTPA
NRFLPTLVHCAGIKCLDIKFTSSVPEVIQRAYCDAVSDVVLQMNHLVSLTCGYLTHDALV
HLGSLASLRSLSFTLSPGQPLADLTMLRDGLFQNLDTITVQSFSNLEESSAFLNVLAKRP
KELLFTAPKIGHSELVGLIGKLTAGGEADNPNEAADIPECTTLVFAADDAQDEEDELIPP
HFYEDSFLKLSDLIPLFKFRSLQNLAIEGSMPVSLTDSEVADLASAWPNIITLNIGGK
Download sequence
Identical sequences jgi|Conpu1|156131|gm1.8122_g XP_007771208.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]