SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|156567|gm1.8558_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|156567|gm1.8558_g
Domain Number 1 Region: 165-250
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000889
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|156567|gm1.8558_g
Sequence length 635
Sequence
MSGGDPRSSAAVSSAGGSKPRLPKAYTDDQLNFLRGHVQGFESRTRGAVRGDAKKFALER
ADEFLMTFGMPDDLRGTEEAEPRFREQIYNWYKNTVGRARRKMEGRTRGKGAGTGTGTKG
VGGMDKMSGSPAATHSGLTWSPNLSSAVSYHDQTQQHDSPASQAGPSAGQQQQQQHGGQQ
QHGQHQQHGHTQQQQHQHGQQQQQQQQQQSQYHYPFQTHSALSVPSPGPSALSLGVGSMG
SPTPPLRDAFLASSSIDAGTLSQLIQQYALSHPSAAPATPLAPVVQALFDAATAILAGAG
GGSHHSSHGHGHGHAHSQRHGGGASGGTTSSSNLHALLRRYADACAFFPPNVAHAGVHGP
AAGARALSMALRTASVWRPPGFPTHNATSTSSRGSHGVGVGVGNMERIAADRQRRKDYIV
WAQVHGAALEVGIVVVPAPQGIGSGTGNSNAGSGGGYGGSTPGGTGAAGGGMVGGYDAGG
MHGGMHGGMGVGVGVGVGVGGAMGSSSLGGAMNGSIGGALGVVGGGSGTAGSASSVGVGG
VGTGVSEQVSSFSEMMARDAVWEADEVEWVAGMCVLRALIRVGGAARKDEYERLVRTYEG
RWKEIRDEARQALVTEVLLSAKEDLARMDDGQRIS
Download sequence
Identical sequences XP_007771599.1.51617 jgi|Conpu1|156567|gm1.8558_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]