SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|156972|gm1.8963_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|156972|gm1.8963_g
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0262
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|156972|gm1.8963_g
Sequence length 77
Sequence
MCYVPLKVWPPEAFEEGLELMVSVAKAFENTYCLRCKVVLAEILTRSHHGEGKTAQAKWD
KATEKTHSRVKDMMAKP
Download sequence
Identical sequences XP_007772132.1.51617 jgi|Conpu1|156972|gm1.8963_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]