SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|158023|gm1.10014_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|158023|gm1.10014_g
Domain Number - Region: 32-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000618
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|158023|gm1.10014_g
Sequence length 1074
Sequence
MSHTQCPSCSQSSSTPEEDLLSQRPLHSLLRYPCRAEGCSRLFKSKGGLTKHISSYHDGL
VDSSPAPSSPPPVDHDLQDEPPMDSFQPEDHELPEHLEPQSEHPRGRVEELDGGKRIREY
HPVLTGDRCNPDGSFISEDNGPFPLPARAPDDWHPFRSRVEFETADFLYRRSQAPAGHID
ILMDLWGATLRKHGDTPPFADHKDLYKTIDAIKAGDVPWESFSMSYKGAKPAGAVPPWMT
QSYDVWFRDPQKVVRNILGNADFRDGIDYSPYREFDDSGHRQFEHMFSGDWAWQQADEIA
ANPGTDGCTFVPIILGSDKTTVSVATGQTEYYPLYLSIGNVHNNIRRAHSNAVDLIGFLS
IPKTNQSFTGDPVFRHFCRQLYHSSLSRILQSLRPGMTTYEVVRFGDGYFRRVMYGLGPY
IADYPEQALLGCIVQGWCPKCLAFRDDLDGEPALPRTREHDDIVIEELDLGTLWDYYGVI
GNVVPFTNDFPRADIHELITPDILHQLIKGSFKDHLVEWVVSYFHKKYNKAKALSILDDI
DRRIAAVAPFAGLRRFPNGRGFKQWTGDDSKALMKVYLAAIEGYVPRRVVRAFRAFLEFC
YLVRRDVQTEETLREIDDALERFHKYRKVFTKLKVTTSISLPRQHSLIHYAFMIRQFGAP
NGLCSSITESMHIKAVKEPWRRSSRFEALKQMLLTNQRLAKLAAYRVELTARGMLQGKAS
SESDVLNVIQRYDSIFYFAAADPDPTTLIRIRGMTGGSVDVAEDERDCVINKQVEAKVKL
AKTKARKRARSIPALAEELTLEEFDLLYQVRCFLYNSDLPTSQRGSVDVSAVPVAQLPPF
DPKARIYVYNSAAATFRAPSDISGIHGMRRERIRSTLNWRNEAPRHDCAFVSTDEDVPGM
LGMEVARVMAFFSFDYSGTHVRSFIGFLVQAMCEIPTPVFIPVGSLVRAAHLIPYYGSDP
VPETLKHYDSYNDFHVFYVNRDNMNVSTIPPSCCCNSLGPARSSLANAILGCRQPTASDN
DKPVAPLAQCTPPRWPTIILHRPPNTTSQEAQPAAVPADMRSLPVKPRASHGPN
Download sequence
Identical sequences XP_007773190.1.51617 jgi|Conpu1|158023|gm1.10014_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]