SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|159052|gm1.11043_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|159052|gm1.11043_g
Domain Number - Region: 67-110
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|159052|gm1.11043_g
Sequence length 289
Sequence
MAPSETEDFKEQMHDIESSSESSSSEDDDEANGDGDVADARRLETNEEARIYVEIMAVNP
ETAATPELRKAFKWAQNEFVKARDQSLEYCCRIQELEEQIAELSKPRKRSGNTLEVKIAA
IGRQFCYLFRPVVPNYLFPLRGVEPLDPRHPMRYDKPEFMRRCLVTAFVGFLPLELRKAV
KTYPNFEQKFLQGARSEIGLFVNTIKTIYPHTYAGLGISAHGLAKAENLCRDPTVLWLLE
DPFAPEKDGSDGDSADKPGNEEEEEEEESESESIPTFPRILYQDPYTPT
Download sequence
Identical sequences jgi|Conpu1|159052|gm1.11043_g XP_007774304.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]