SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|159927|gm1.11918_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|159927|gm1.11918_g
Domain Number - Region: 140-186
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0557
Family AN1-like Zinc finger 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|159927|gm1.11918_g
Sequence length 683
Sequence
MCHAHLPPLDIDGKPHCPMCGCELKPKFCSKGREDHIGRYFLVCDNKAGHPLTATGKGQS
FWHWYPLNGAPDCIVLLADNSCSPGSSPSSSPPRGDPGPSTSSLPTLPPLPSILSRSTSL
AAGQLAPQPAYPPLGPFVPGLKLKCSFLKCNKSAPNKANSRCAKTMCKKHCIQDFIGCSS
AKDHRPECAGKLQQASFAALAAAGSSTPSLASSAPRAPRAPRAAPATPSQSLTSWPDPTD
EEWGLNPQFDDLSVLSEVAVNFPEFTFSSVDSPPPDSPVPPPSLPSSFLPTQLSAPPPSQ
PDAPAPSQPRTLTARTGRSSQPRGLSTRSAPTTQLNDSWQKVIHDVVVEEDLLQKDEQEQ
LSREEESCQEIELITYIENNKLPIKLALQGSNVPSHRDTSPIPHWPYFDLAGAADKTPQL
PKMDHNTHVEFWDGRRKHWKGVSAFHRIPVKNQDVLVFRINGTTACVDEKTYTSPCYKSG
LPADRLKIRAKLKEPVRSKRARSPTPEPSSSSQASSSTSPGSPSSSQASEDARSNKRLRT
VSPFVLSPNRAEQMLDLAFLGGPQPPGPSHSVPLLLDDPRIGNTPSPPGTLRDARIRWGQ
ADEEFKENIRAPADSDLDMDKKERLWDKVTATYKLKPTRSRRQVAEMHQAVCINVETSPP
SLYAELGSDIEGDGDDIVMVEPL
Download sequence
Identical sequences R7SEN6
XP_007775237.1.51617 jgi|Conpu1|159927|gm1.11918_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]