SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|159976|gm1.11967_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|159976|gm1.11967_g
Domain Number - Region: 366-408
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0626
Family Clp protease, ClpP subunit 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|159976|gm1.11967_g
Sequence length 846
Sequence
MNTEPPGPKDHRTWTHRTQHKQANWEVLLPSLVAAYIKWKHPESTQAAPPESVPSTSRES
TPTPSLESAPATPPSDAASAPDTPVLDLPQRCDFDISVVDIYTLSSIAHVPRLGTERTAE
ALVSAGYLGATPEKPTIAFSLPTLELFRRLRLRKPSFSVEAFAKVICDFYQWPYHRAYRI
ALSEAFDMYLSIVRTVDLRVADALGRGDPVWRAKNCCPVCSYELEDEPDLRYRRMLVFDG
NNSLSRMAPVGSRSVADQCIYHSSYFLEPEYVDRFANIAGSSPPTSDSLTADNDTAVISA
CTDSWKAAAADAKKKSWGIFEETGIFSCACRHGFMLYIADMVRSGELFKYPLAIVNKSLE
DFGDRILIAYDIGCKLAITIASSSDLGPRFASSGSRIGSNQVSITTRHASAYKRRQAIEM
YFVQWDEDRYLVIADGLLRHYKQALKILTDESPALDHTKRALNVTDADLTNWRTEQSTFL
ATSGQESTWDVHAVAYVEMLQELWEVQANAARAHATLVNSVPTNYHFVAQPLVTSAKAYG
AETSRTGRQESAHRQARAKVVTLENDVLALETKMGIYHRWTPIDQNYVATAKYINERKYH
RALDNLQRLVVLRLLELHKLNVGRSGYKLRTYIAKSLQNRCKAIQNALKMFNQAAVELGK
PTLEWSRVSKYTFLEEFTLLRETGNDIRQKRWVEPAIREVMKLVQKVDRAKEEIQRCNVE
IRRLHTSVMDEDSLFSRILSELRRAEAPIVGPVAEYCTRRRRANAQVLRRLRDIYELPGF
SGTPEPGTRKGCVQSVRDATAGSTADGVRPHLYDDDDDDHDDGGDEMVEQIDGVVDFLTN
LSVDTR
Download sequence
Identical sequences R7SFQ7
jgi|Conpu1|159976|gm1.11967_g XP_007775277.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]