SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|159987|gm1.11978_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|159987|gm1.11978_g
Domain Number 1 Region: 17-242
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.97e-36
Family Eukaryotic type heme oxygenase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|159987|gm1.11978_g
Sequence length 295
Sequence
MATNSTSIEASQPASVYVREATRASHERVGSAQGARWLAGGQLAKEEYAHYLVLLWHVYD
ELERSLAAHANDPVIRPVYVPAIFSRADHVAADIGFLLNTATAEGAWRAHPMVAGILAAP
PQVLIEYTARIKYLCAEHPRLLVAHAYARYLGDLSGGQIIRKNVAKAYGLDREDGDGLQL
YAFRALNRDAPASANEVKVLKEFWRERLDGAVGGDVELKVALAEESKLAFVLNEGLLSTL
KGPAYECVYVPGRGAYNIVRGGASSNKSVKTLVVLASIIGAAGLAHYLYGGGRGQ
Download sequence
Identical sequences R7SFS0
jgi|Conpu1|159987|gm1.11978_g XP_007775287.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]