SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|159995|gm1.11986_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|159995|gm1.11986_g
Domain Number - Region: 387-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000139
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 465-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00268
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|159995|gm1.11986_g
Sequence length 569
Sequence
MAGTSQPIAFTSVEDNTMDINMMSTSYTRNGSLSASYYLGSPASWRAGSYGSRFYPGCSP
GQLMGPLDPSDFKCAKISSSVESDHGSLINALGALERNDEFCKNYSCCGLQIDDLHGLLQ
HFEEVHVVVTDAFGNPRTLVPPSQHPAPIRTQRATHYSEQTQQPTPQPSPSNQGSFDPDD
MELDMDQSSAPSSGGSSPPDTPLTTPLLSQPMTSLSDLAASKLSDGQMPVSAFDTTVLSS
RSVNGAFPSSYAMAPSSSSAAPEGFNSHAGYSEYSSSMPGTVPSTPVSEEPMHSQTGSEP
GSPFGCLSPALVFSTTTTPANTPAHSRVPSPSNFMRAIASASVGAYASTSSEGAGPSSKA
SRSGSPAQNSIRASTTLSRPASSLLLSKPFKCPKANCNKSYKQANGLKYHMTHGSCNFAP
PKDLEHVQALLASKRSQREAAGEDSNQITEGEMREVEREAERRLRPFACGIADCQRRYKN
MNGLRYHYQHSGDHGAIGLGLLASGQHECLQHTHGKGGSRHATPHGNVSGASTPVGSSGP
PTPSYAQQYQQQMMFQSAQQQQFMRSMQA
Download sequence
Identical sequences R7SEX3
jgi|Conpu1|159995|gm1.11986_g XP_007775294.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]