SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|160319|gm1.12310_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|160319|gm1.12310_g
Domain Number 1 Region: 21-242
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 6.41e-57
Family Osmotin, thaumatin-like protein 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|160319|gm1.12310_g
Sequence length 244
Sequence
MNYAIKLSLFAFVSDTIARSVTVQNNCSFTIWPAMYTETGAAPSYATGWEAPPDTQVTFD
APTGWRGRIWGRRDCDFSTSTGACIDGGCDGGLECSGPGSAPATLAEFALDSDEQDYVDV
SVVDGFNLPLEITDSANCGTPSCPVDLNTNCPEPLQGPFDSSGAPIGCMSACEAKISGDP
SNSPDCCTGNYSTPATCPPSGVQYFSYFKGNCPNALAYVYDEGSTALWVCASKPEYTVTF
CPAS
Download sequence
Identical sequences R7SDN6
jgi|Conpu1|160319|gm1.12310_g XP_007775633.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]