SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|160743|gm1.12734_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|160743|gm1.12734_g
Domain Number - Region: 193-230
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0706
Family AN1-like Zinc finger 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|160743|gm1.12734_g
Sequence length 279
Sequence
MCPGGHSTTSGCPTTSGSPSTSSCPSTSSCPSTSGHPSTSGGPSTSSSSHFSSSDEPYEI
DGVPYCPWCHLPLQPRRCANGRMDHINRYFVVCENVHAHPLGRGDKLRKFWHWYPLFEAP
EHIMLLSDNSWTPLSSPASSTPARSPATTIPLPALSIPQSTPSAPPTSAASQPVPPSRTY
PPLGPFVAGALKCIWEGGCTKSAPNQRNSRCSKTMCKKHCIAADHMGCSTAKDHNPESAG
KLQKATLAAQVTSSSSSALPPSAPALSIPMARPPSMHVR
Download sequence
Identical sequences R7SFB4
XP_007776059.1.51617 jgi|Conpu1|160743|gm1.12734_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]