SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|160988|estExt_Genemark1.C_1_t10261 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|160988|estExt_Genemark1.C_1_t10261
Domain Number 1 Region: 198-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000191
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|160988|estExt_Genemark1.C_1_t10261
Sequence length 549
Sequence
MVPHSDFSYGSMDSNSSMGSSSHYQIDTISSSYSSTSSMPSYPSLYSQSQHLSIHPLPPP
DDDATGSIFGVPGYADPEPSLGVYTHPSHSHQHALGLHLLPAAGYPSSYDLHHSSHAQPN
NMLIPLHAAHLLPSPPESRLPYALSAQDPSEINNGQLPARAHSAAQASAANGTAYGAAAA
NSGRSRHEGGAPPRERARKHGCWMCEKSFDRPSTLKKHLLVHTGVKAYVCDICGRRFGVA
SNLNRHVKRCSLKPANAVAAAAAMANNGNTSPASVPGSISDEKSNDTETHSSIDQEGGTT
AKRSRTSDGSTMSTLSSALTDTTLASSPEASSFPPTSIASTQTKRRRRAPSPSHWVPPSL
RAFNLSPSEACRSTAVPLPPVRPWLGHSSGFSLPTSPLPLTPGSVSSTDSAAGFASASAS
ASASGCVMPADAGTLLGFASSASSCSPSSTPWHTPTSASDLPWPEERDSWDDSAARLPYH
PSEWRGRLPGPGLGFSGDDAGYGGYGGHGGGGSGGGVSSSGLSGLPVVAGGGLVKAQSYV
VGRLVMPVT
Download sequence
Identical sequences jgi|Conpu1|160988|estExt_Genemark1.C_1_t10261 XP_007763070.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]