SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|161215|estExt_Genemark1.C_1_t20048 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|161215|estExt_Genemark1.C_1_t20048
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily Homeodomain-like 1.21e-25
Family Myb/SANT domain 0.011
Further Details:      
 
Domain Number 2 Region: 95-162
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000207
Family Myb/SANT domain 0.031
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|161215|estExt_Genemark1.C_1_t20048
Domain Number - Region: 687-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000217
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 760-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0112
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|161215|estExt_Genemark1.C_1_t20048
Sequence length 833
Sequence
MERSAGRPWTANEDDLLVQAVALHGESDNWKAIARAVPGRTNKACRKRWLHSLSPNIRKS
AWTPEEDRVLLDLYKIHHTKWSVIARHIPGRTDDACSKRYREALDPSLKRDEWTQEEDDK
LAEAFLRLGGRWGVVGQELQRSGLACRNRWRLLERKRSTAMSASTDQRVQQPLPSSLPPS
EAPSPLVEYQPAPWSHTPVYSQTPQWDIPSIDDTTLRHSFQNTGAPLATDVSFQYSSSSL
SSALSSPHPSSSDFGAGPSTHQHQQHEHHSSQRQQPLTVTLPGYNTDHRTPDAAHQGYSL
HFDYHSDFSTPSTPAVTDNLSYQQQQLHVGQSNEVTLPSPANSHFDSYIPQPQTQEHVSS
HSYYTPQAEHVQNAPTPQHQLPQASTRPEGDMMHFSGSQQSHSQMNMPHLHSAHDHSGHS
SHSVYLTPQSQYEHQNNVDVSALHQGPYYHGGQAPNRASQQPMPERAQSATPCGEQQQQQ
AGTKPGFYPPIPPVQIRNSANFPVHRTYIHPSERALSREAGAHRTYMQPGERQNSYNSAS
LAQNGQRAAGAGSPYPGYMRGSSSSSSMAPPPTPKSESGSTSQLEQGGAASSDTQPDGGF
PGAAGDYPRGGPRPRPRPMGNRRRPDLQAPLRLSSDLPATNDPNVKPYACGHETCWPAEA
KQSSHMFRTSRGLSDHNKAAHPDDAGGDRPYRCGLEGCGKSWKSINGLQYHLQISKAHFQ
HAISTTIMRTSFNASVEAAQSSASSGGGGSPEDGEDKGKKQYVCPHDNCFNRYKQLSGLR
YHLAHGHPVDMPVQLDLVPPALSRRLNEKLQASSGRAAAPRLAIEAVCDDLCC
Download sequence
Identical sequences XP_007763274.1.51617 jgi|Conpu1|161215|estExt_Genemark1.C_1_t20048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]