SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|162180|estExt_Genemark1.C_2_t10235 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|162180|estExt_Genemark1.C_2_t10235
Domain Number 1 Region: 34-219,293-371
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.83e-51
Family Crotonase-like 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|162180|estExt_Genemark1.C_2_t10235
Domain Number - Region: 217-298
Classification Level Classification E-value
Superfamily FliG 0.0212
Family FliG 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|162180|estExt_Genemark1.C_2_t10235
Sequence length 480
Sequence
MLRTALRRMTRNSAPALARTQAVAAHMSTSAPDAQPVLFESRGTMRQYILNREKKLNALN
TEMLDILRPQLEEWSKSDLCKVVVGSGLGRAFCAGGDVATVLKDSLNDATRPNSIAFFRS
EYELDYILSVLPKSYIALLDGITMGGGVGLAISAPFRVATEKTVFAMPETKIGFCPDVGA
SFFLSRMDGQVGTYLALTSETLVGREVFEHGFATHYIPSTSIPTLMARLADLDNPTPELI
DRAIEELHAERQPNDAAGKFTGKTRQALDSAFSHDTVEDIVKSLEAFASHEDTGVRDWAK
ATLETLRMRSPTSLKVALAAVRRGKKLSLLESLQMEMGIATAYCSGASPDFRTGISAVLI
DKTQGRPTWTPDSIDQVTPEIVDRFFNKSSTYVASSPQLTPPPELRNKNKDPMRFALPTE
ATINDTINSLSSGGSVPLSEVLAKFDDLRSGKNGIKEKVMDVVQRRYKLVDQGGNQFIQS
Download sequence
Identical sequences jgi|Conpu1|162180|estExt_Genemark1.C_2_t10235 XP_007764535.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]