SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|162521|estExt_Genemark1.C_2_t20117 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|162521|estExt_Genemark1.C_2_t20117
Domain Number 1 Region: 1021-1031,1078-1460
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.66e-90
Family Formin homology 2 domain (FH2 domain) 0.0000178
Further Details:      
 
Domain Number 2 Region: 200-587
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-67
Family Diap1 N-terninal region-like 0.00062
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|162521|estExt_Genemark1.C_2_t20117
Domain Number - Region: 977-1086
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|162521|estExt_Genemark1.C_2_t20117
Sequence length 1614
Sequence
MDSFFGRKKGRPRQSSGDLSERSVPYDQLAPPSRSPMPVGTVSQGLRGTSVISAPLTNPT
LTSDGTKLNFQAIQRNRAERERYANASTTSRPDSTFSTSDSGTLYNESLNTNASKWPATP
ASARQQRVRRSEASSSTGRRSPSGSEYNSTYIPTSPSTQTASLRPSSEAGSHHHLSYHLN
LNRHGPQDDFYFPRPDDEGVEALFQQVKQTRAIPDSQTLTIDQKWKIVHGDEHLRWLEEK
NREETSRKQGESLAAPIGEGSPDWYIKKFLDKTITAKQASSVWVSLKNNEISWMERFLEL
QGTSVLAQALYHISRKGSERRHGDVPLEKEITNCLKIIFNHTTRVREALKHPNVITQISS
SLNSPHLPTRKNILEILLSTIYCSRESIGLVFTALETLSEVCVGTRGCYDYWFKSFETAL
NGRGRMGSLVGASEDVKTLSGADGSLLDYALSNVFVVVRIMDALDDIDLRIHHRSLMESA
GLQRIIALCREFGVPPMDKQLDDLQDILEEDELKLRERFDQDILRNLSNLEDVWNAVCAK
IDNTPAKAHFLSMMQHLLLIREEGPGMVQYYQLMDSLVADIAMDNKLGGAEQRLGHSVQR
LIAQLNETERYQTAAIDADKLRAQALQLKLERDALEEEVAQGSGGLVGQLKDRVSRLEDN
LAHSRETVTRLQGQLVTQKAGYEEQIAQLEQQIMELFRMLRELGTGVNKIIDSNSGSMDR
KTLIETLNKHLERTKTVSILEGRGKKKKGQGQGDDGEETGSSDAESRDATPRKSSRQANG
SSSAKNMGNGKARASEAARSSQFMDADEADAEQQVKLQFETLSPQGNPVYSSRSIRGSPR
RMGPRLPGDINASLPRSYKAGNLLAPGQEDSFEQVGGEANGRGEDQDGESEFGRSIKSGF
STFTDETNATSVVSSDEKAGVLAPGSFADALKNHLKARGGRSPSSEAESDSPSQALTPLG
EVPEAEINVSTAEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAGIPTAGASGGSG
PPPPPPPPPPPGARGIASTPSSAPSSARASMLLGANFNVLLAARKDMPITPGTKMKQLQW
DKLPQQQVSKTVWNDDDSQKEREMLEKLKTNDVWTEMEEDFKAKQLMINLMAKQRQAELK
SVLDAQTKKRVEILIRRVKSLEPEEIARKIQQFDQEMCTETFLSELKGVLPTPEQVGKLN
VYRNAGPEELGGLHPSDRLMVKLIQINRLAPRIEGMLYKCKFDESWALLDDGAKKVGEAS
EALLHAKNFKEVLNLILMVGNYMNGTGIKGGAFGFKVSSINKLVDTKSVNNTTLLHFLER
TIAKHFSGIEIFLEELSKPAEAYRVNIQDTRKDMGELREGLRRIRQELNDYYTDIAEHDG
FSKYMWSFMGKATSRIEYLVDDVTHAEATFTEVVRYYGEDDQTISSTEFFAIFKTFVTSY
RKCKAENQNAADEKRAVEKRKQMFAESRERRQNHQESGPQEEDSAVLDNLLEKLRNGDTV
NKRTRKTRNKPDWRPTAPLLSTDTDTPQSDTADMARNMLAQLQADGFSAPSPVTPTPRRR
TRKRTAMLSEAEETSSAYNSPLATHSELAENDLTPEPTPEPEDIPQDADSQTDA
Download sequence
Identical sequences jgi|Conpu1|162521|estExt_Genemark1.C_2_t20117 XP_007764818.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]