SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|162824|estExt_Genemark1.C_2_t20480 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|162824|estExt_Genemark1.C_2_t20480
Domain Number - Region: 122-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000174
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 75-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00194
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|162824|estExt_Genemark1.C_2_t20480
Sequence length 464
Sequence
MVSTRSSTKAMNTRSSTRSGRITKEAPKTKTVRKAKATPKAKAVPMGKAPSKAKAPPNGK
TLLKNKTDSTRKNAKVFFCTECVDRGFTRKSDLQRHAIGHRPDAEKFKQYCTKPGCSYGT
MQKGNLKNHMVMHTQSAFRWCLIGDCDFSCTDPSSANRHRKRIHLMSAKQFREYCKTHSI
DASPRPTRPGSVHAPTEATSERTDSGYGLGSPSAASSSAPNGNSEVNLDDLIAFSEEHSE
AGPVDISYYAPDSPLTPAASPSPHLAQPGIAPPSPEDHITRVVIDDNIPQETESTAYTEA
YQRESSTFEAEGSSSLPDRSESVHSFSSATSTHVGCGTFDPSTILPMPENYQPPSPTSLY
GGRLSSSLEYYPLCMRTNTLHGDHSSQIDASSYGHDAQQGFHYSSEMHLASSMDGDQEFD
IEMDGPAPDFDFEVPAPVSTATPRGVSIFGGRLWADWFAPESSS
Download sequence
Identical sequences jgi|Conpu1|162824|estExt_Genemark1.C_2_t20480 XP_007765087.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]