SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|163061|estExt_Genemark1.C_3_t10173 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|163061|estExt_Genemark1.C_3_t10173
Domain Number - Region: 216-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000151
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 249-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00201
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|163061|estExt_Genemark1.C_3_t10173
Sequence length 311
Sequence
MSSSDVSITLSISQLLQFQVVAGLVDMQPNLQLKPTPQPTFAPVSSELSSVDIKVETQYV
GGQRVLRIFALPSPGHPNFYNTPSSFLAPPTSNPLQCLTSGSANAMSDCASTATSPDDFD
SFTQDELLGSYNNIFSTSSASTPEKTAPNCLSLPEHQWQPSMNTTALQACPYLSIANSPQ
YVAPTSPPYSIPSTASTPTFSTPAEEDTTGPRKRPRRFPCLDPSCPRRFANQYTLQLHMT
THQEIRKEPYHCEMGCSETFSRQHDRLRHEVARHGRVSEWTCNRCRHVFSTQSTRNKHKC
PDLIPADNYRS
Download sequence
Identical sequences jgi|Conpu1|163061|estExt_Genemark1.C_3_t10173 XP_007765663.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]