SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|164770|estExt_Genemark1.C_5_t10443 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|164770|estExt_Genemark1.C_5_t10443
Domain Number 1 Region: 384-590
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0000000288
Family Nitrous oxide reductase, N-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|164770|estExt_Genemark1.C_5_t10443
Domain Number - Region: 211-320
Classification Level Classification E-value
Superfamily PH domain-like 0.0316
Family Ran-binding domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|164770|estExt_Genemark1.C_5_t10443
Sequence length 749
Sequence
MNIFRSLIGRVWQDPNAAEVVKISSGRLYLGRSGGIRPSRECIYNGAMATVRRVPSVEHN
FQLVITRVYEDGDQELLEDEDETDEEKVFLIGQELEFRPSDTEEGPGFLWRDLDGDIDEF
YEFVAFDTNEPTRAFFETCMYRAMYERKYRASADDVPDLELEQFIWKATDIDDKGNHKTV
GDEEAIPSDSTPKIPIMPPDDPGKPSIVAKPANLWLWNPDAEDFVSAYDEVLYAKIVRRS
TGDYDYWLAAASDRGELLSHKLDSSMNPRWASKTISLTWNYYSEGSQKSWALQFLNEEDY
NEFKDTVMRCGWEILHREPWGKAKQDEQAYVMSSAYEDVEMQDVEDEEEDADEIESELDP
DQEPSDDGEEDEEEDAVPQIKGERNSQLTVGYKGDRSYVVRGNNIGVFSHTGGGDNVKYH
ATISKIATPKGKEFKPQEVMLHDQDTKMVLMNPSNPNSLFNLDIERGKVVEEWNIHEDVP
VNHIAPDNKFAQTTPEQTLVGISHNALFRIDPRISGSKMVDSQFKQYVSKNQFSGVATTG
TGKLAIASEKGDIRLFDAIGKNAKTALPPLGDPIVGIDVTANGRWIVATTKTYLLLIDTL
IGEGRYAGNLGFDRSFPATSKPIPKRLQLRAEHVAYMNHDISFAPARFNRTEGQEENAIV
TGTGQYVIAWDFAKVKKGQLDKYEIKKYEDIVVQDNFKFGDDKEIIVALQNNVLAINKKN
LKRPTRHSLAPIASGSGSKSKSNIVNTPY
Download sequence
Identical sequences jgi|Conpu1|164770|estExt_Genemark1.C_5_t10443 XP_007767910.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]