SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|165109|estExt_Genemark1.C_5_t20330 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|165109|estExt_Genemark1.C_5_t20330
Domain Number 1 Region: 212-299
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-24
Family Forkhead DNA-binding domain 0.00069
Further Details:      
 
Domain Number 2 Region: 19-124
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000268
Family FHA domain 0.0062
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|165109|estExt_Genemark1.C_5_t20330
Domain Number - Region: 501-547
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.0817
Family Ribosomal proteins L15p and L18e 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|165109|estExt_Genemark1.C_5_t20330
Sequence length 629
Sequence
MEDGQAKISAYYSLVFPNITFFLQTLAVTIGRRAIPTTTPSSSADTLQTQVDVDLGPLKS
VSRLHAKIEYEETSQRFVLVVMGRNGAWVDGVWSPSGSRVPLSQRSQIQIASRTFHFVLP
PPPPQELSPSPSSPSSPRRARSPSVDITSVDVTDISPPSSIPPHSPPQLPVDKPPVKAEP
KVEPRSPPPQVSKKRKKMHTELPPPPAVMPPKPQLTYAQLCYRAIKAMGGKATLHDICTW
MIDNYDWYRYNQGQGWENSVRHNLSSGRAFKKMERSSGERGKGFYWSVDEQFEHTFEEQA
EGAPKVKKEKVPPLDPPLKRAAKSGPLPPPLTNTPLPLKSPFSTTPLPPPGQVIVKQEPA
APPTLASAMAAAAASTSVVLASVTPPAPGATGPANPANSVSTTTASTPTLQPLHSPPPPA
STPSLALPASVTLPIVVGPLPPSHPQAQASNPQPIVLHNNSLILSPAIFSHLTPEQLKEL
EALGAQKALEILQGHIVRYLKEKMRSGRGRGRGRRGAAGGAAGRGGKGGGERGDGRLSEA
TNDGKQGSPFTNVPLPPRTDSTAPTKFALSAGKTGETSTSANASTAAALDAPPARSESPI
IVVDDDDDLDMHSAKRPRLEGEGEPLSIV
Download sequence
Identical sequences XP_007768163.1.51617 jgi|Conpu1|165109|estExt_Genemark1.C_5_t20330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]