SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|165374|estExt_Genemark1.C_6_t10288 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|165374|estExt_Genemark1.C_6_t10288
Domain Number - Region: 240-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000398
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 273-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0779
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|165374|estExt_Genemark1.C_6_t10288
Sequence length 342
Sequence
MSSELSLTFSISELLRFCVSFGSANDPSSLRLDPAPTDLSHLASPELDALPLAIKIETLV
VDGQRRLRVRAGQKEEAIPCKPLPTPMPTQPSTPLLDAWAAPSTSTPTAYIPPQPQLDNM
NFPTTHHQTDIFSCPDMFFDTAAMFCEPSVPYLSESTAAYDYLSEQPKIHDSLIDASKLS
NYSNDSPSNHGLVVHIPEHDPAADCASPVCSPASSCHNGESAETRNETTEPVGPKRRPLR
FPCLHDGCPRKFSSEYTLNLHMTTHQYRDKPKVRYPCEMGCSETFSRQHDRLRHEVAKHG
RMCQWFCSRCRRVFSRQSTRDKHRCSDVAGPMQSESPVQQAQ
Download sequence
Identical sequences jgi|Conpu1|165374|estExt_Genemark1.C_6_t10288 XP_007768571.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]