SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|165479|estExt_Genemark1.C_6_t10421 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|165479|estExt_Genemark1.C_6_t10421
Domain Number 1 Region: 958-1374
Classification Level Classification E-value
Superfamily Ras GEF 7.19e-105
Family Ras GEF 0.00000194
Further Details:      
 
Domain Number 2 Region: 35-108
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-22
Family SH3-domain 0.00074
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|165479|estExt_Genemark1.C_6_t10421
Domain Number - Region: 103-194
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000445
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 
Domain Number - Region: 281-315
Classification Level Classification E-value
Superfamily WW domain 0.00312
Family WW domain 0.0037
Further Details:      
 
Domain Number - Region: 194-230
Classification Level Classification E-value
Superfamily WW domain 0.00341
Family WW domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|165479|estExt_Genemark1.C_6_t10421
Sequence length 1388
Sequence
MAAVGLVSYGGAHQTYTMTEDSQFTTQDDQEQYINTFFCRAVYDYQTNDSSSLSFHRDDI
IEVLTKLDSGWWDGLLGEERGWFPSNYVDVLSDEEAEIALAQIEELHQQNHQQQQVQMQP
QQQAQQQALQQQQQHAQQLHPQQQQAHQAVADAALGGVNGAEYIPSGQHWMVDDPSLNNV
SLNDVITNVPTSAATGQTQSSDFWLPEVTPDGQIFYVNTITGERSRDLPMEADDSPNGDL
AGLTASQPGSSRAGSGANLGFGAGSAPATESAHAGFGVPRRSGTPEPWIRRLADDGMSYY
YQNQLTGEQAWVLPESATPTRAGQEVHGRARAMTNTSVASSAVYASTSASASQSRLRADS
LASQSQSQGSSAGMRDRSRSVSERVSDSEDSNMYSPAQGHSPQPLSAVTADARVQAEDLG
VELTVAEKIAQSLQQSLQPPPPELISELSHRAQNSINEVISTNQQLSTLPRRSEARHILD
ALVEAVVVAVMNLLYISAPPSGHIPSNVLPREARHRRDTTAQQTLLKPAQRKVTATLSKL
VLSARAMEYDSGPASHETPSRIESDAEELHRSIIAFVVEVQRQNQQPTGVSVKRIQGNFL
PVHMGLGLYGGGAAGSWKGFGWVPLDEADDLPERVLDKEALIDLRTKTVMFDRKSEVLRN
RLRGNPAEVLLHAASQEVLAVLSDVLHLVADLHIARHVDIDGIYAQSTQEATARYTQSVD
SARVLVRTLESIAQNLYDDCSALFSATQHIRRPVPGDFREIEERREYFGAVLTSLRGNLG
SLYDTLDALWGVGNEQADMSDVNHTGAIEWRMSRLSIFDSNFDVRRMSTTVPHDPETEDL
VDMELAFGRSNRRPLNAITNATADRMSTYRSPSQLSDNTITFPHEKTGSMSKAPGWADES
TSHTLVHGEDQATLNGGGGDADSVFSDEGTSSRPQRTGKSDKLAKIFGDAPPEHIVPTKP
WYLRPDYGKDQIVIDPDGSVKAGTVSALVERLTTHETRDTTFMKTFLMTFRSFTTLDEVF
DFLVQRFYIKPPSNLKQEELEEWQKQKQQIIQMRVLNTIKSMVQDDVLEKDEMYILDRIR
EFLSDEEAQKITASKTLLLAIDRAVGGEKKMTINTALSPPAPIVPKSKKLKLLDIDALEL
ARQLTVLESHLYLKIKPMECLVRSREQKTDHNDNIAKVIQTSNRIANWVADAVLYHEDSR
KRAAVLKHFISVADRCRTMHNYSSMVAIISGLNSPPIRRLKRSWEQVNARHMSQLSTCES
TIDSGKNFNNYRMTLAKVAPPCVPFIGVFLTTLTFIQDGSKDILPGDLVNFRKRQKASEV
IQDIQRWQSIAHNFQALSVVQNYVEEALFKFPDGSDLGDHFWNLSLEREPREREDEKMAR
LLQESGFL
Download sequence
Identical sequences XP_007768666.1.51617 jgi|Conpu1|165479|estExt_Genemark1.C_6_t10421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]