SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|165931|estExt_Genemark1.C_7_t10252 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|165931|estExt_Genemark1.C_7_t10252
Domain Number 1 Region: 99-214,253-319
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000000382
Family Class I glutamine amidotransferases (GAT) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|165931|estExt_Genemark1.C_7_t10252
Sequence length 367
Sequence
MSSPQPLRIAVFSCGPVEGKMNTELGYTLGAEGTRELYHKLLTENPQIANPLDPTKKIFN
PELAAIAVNLQTTVYDVLGDGKPVPTDAANFDDTDPRLPSEDVLGTIDAIIVSGSGESVR
YVEDEHERGQWEGKIRRLQRYLRYVIDNHPRIKVIGICFGHQILSFASGMAVDRNPLGWE
VGPTNVILNDLGKSVFQKGALIIQQIHQDHVLLNVGIGGTGDSGSGGYGAAPPPGSERPS
DEVVIDKDVTPIDGLGRWGHSDLTSNQGMVKFTEDVVDDLDEPTLHLGALEKIHIFTSQG
HPELDRDMIRVLIEDYSEPQNPGGIPADRALAALARNEDKSFELSVDDLAIVYWQMLKGA
WNAKNAA
Download sequence
Identical sequences XP_007769358.1.51617 jgi|Conpu1|165931|estExt_Genemark1.C_7_t10252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]