SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|166169|estExt_Genemark1.C_7_t20071 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|166169|estExt_Genemark1.C_7_t20071
Domain Number 1 Region: 83-303
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.55e-62
Family Mismatch glycosylase 0.0000248
Further Details:      
 
Domain Number 2 Region: 339-391,425-460,504-532
Classification Level Classification E-value
Superfamily Nudix 0.000000649
Family MutY C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|166169|estExt_Genemark1.C_7_t20071
Sequence length 540
Sequence
MPARKRSRVSDSEDDYEAIDDDSDASYSAHAPKTSNRPGKRAKAKPAGKRTKTKSAVVED
AEESISSEPHAASLHVISSPEPLRAALLDWYNVVHDVRGMPWRKRYDPSLGAEERSQRAY
EVWVSEIMLQQTQVATVIPYYNRWMEKFPTIEHLADADDETVKALWKGLGYYSRATRLHQ
GAQIAVKDFGGRLPTNAKEMEAKISGIGRYSAGAICSIAYNECAPVLDGNVHRLMSRLLA
LHSPPKSKQTLDVLWAGAEAMVKRAEHPGDINQALIELGSTVCKPRDPACSKCPLNKWCQ
GYRLTKEESMEDAPDIEELCTLCAPVTADEEVGSVTIYPMKAERKKAREEMDSVNVVEWR
HKNTNERWFLLVRRPESGLLAGLQEFPSIPNISSTASKLAEAPYTLLEGLLSSPPRKQKA
AQGDAQSPRITRVKPAGDVIHVFSHIRKTYRVQWVLLEGGSENGSRPPALLPRPTITNDA
PSRGPESKKPKGKKNSVNASASQPAVIAQWVRLDEVENANISTGVLKIWKQVQSMWNWND
Download sequence
Identical sequences XP_007769620.1.51617 jgi|Conpu1|166169|estExt_Genemark1.C_7_t20071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]