SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|166385|estExt_Genemark1.C_8_t10192 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|166385|estExt_Genemark1.C_8_t10192
Domain Number 1 Region: 210-341
Classification Level Classification E-value
Superfamily Plus3-like 8.11e-35
Family Plus3 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|166385|estExt_Genemark1.C_8_t10192
Sequence length 556
Sequence
MSDSEGDFSDELLELAGATEKKRRKRQSSNHSNKKAKSNVSMGSDESDRDVDSEDDLNPF
PLEGKYVDEADRERLLEMTEIEREEILASRMEQLQRKQDSKNLDALLKAQKAGADGSDSI
VKAAKRQHAARGATKEKSSKLDELKAKRRAKEQKKRTRTNSPKGDRDSSPMDMETSSGEE
EDGQISKFEEDDDMLRKFSRKSKDDNNDEPITRYDLMAIRVSRDMLARHCLAPWFEDYVK
GAWVRYLIGNEKDGQPVYRICEISGLAMNLTKPYKINDTLIDRAIELKHGKSVRAFNMDK
VSNSDFPEKEWDRLKYACLTDHVAMPTRRAIEKKKEQMARLVSQRMTDSDITAMLARKNQ
LSSGVQSAAAITMERSRLNQARTLALRRQDAVEVAEIDVKLAALPEVAATRVAEEDDLAA
RLLKVNERNRKANMEAVRKAELLEAERKRKERKLANANGSGVSTPVDPSARLRTIPKMFS
DQSRDTSVDLPYILLVDRSGTPNANGTPQVKAEKDALRPVSPLPPSALSGTPAASDKPKS
FQASVIDSVEVDLGDF
Download sequence
Identical sequences XP_007770026.1.51617 jgi|Conpu1|166385|estExt_Genemark1.C_8_t10192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]