SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|166494|estExt_Genemark1.C_8_t10331 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|166494|estExt_Genemark1.C_8_t10331
Domain Number 1 Region: 99-181
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 9.94e-31
Family Ribosomal protein L31e 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|166494|estExt_Genemark1.C_8_t10331
Sequence length 205
Sequence
MEDGMSEVTVRTELKQLQERQTEQEGRYWIKKGQPLKNEESGAGDNLKPWPPRNPRKRCT
IPIHPPPNERAHSSSSPSLSLHPFILLQTGGKTRSALQDVVTREYTVHLHKLVHGRSFKK
RAPWAVKSVVTFAQKAMGTSDVRIDPKLNQALWAQGIKTVPHRIRIKLERKRNDEENAKE
KLFTYASHVPVVSFKGLQTAVVDAE
Download sequence
Identical sequences jgi|Conpu1|166494|estExt_Genemark1.C_8_t10331 XP_007770137.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]