SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|167585|estExt_Genemark1.C_10_t10474 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|167585|estExt_Genemark1.C_10_t10474
Domain Number 1 Region: 105-247
Classification Level Classification E-value
Superfamily L30e-like 3.26e-30
Family L30e/L7ae ribosomal proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|167585|estExt_Genemark1.C_10_t10474
Sequence length 279
Sequence
MLGGRLLALEAPPKAKAGSSKRPAPAPGSAARTVKSTKNPLFEAKPRNFGIGQDIRPKAD
LTRFVKWPEYIRLQRQKVILAQRLKVPPAIAQFSHTLDKNTAINLFKLLNKYRPETKQEK
KTRLETAAKAVADGKEATKNEKPYFVKYGLNHAVALVEAKKAALVVIAHDVDPIELVVFL
PALCRKMGVPYVIVKGKARLGTVVNKKTAAVLVVEEVRSEDSRELATLISAAKANFSDKY
DEARRQWGGGNRGNKSTQMLRKRAKASGQSINAASIGKL
Download sequence
Identical sequences jgi|Conpu1|167585|estExt_Genemark1.C_10_t10474 XP_007771615.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]