SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|168152|estExt_Genemark1.C_120158 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|168152|estExt_Genemark1.C_120158
Domain Number - Region: 176-232
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|168152|estExt_Genemark1.C_120158
Sequence length 587
Sequence
MSPAALNASNDSPSPTKLKTKSPKPRQLQLLDSNYSPNPSTYSQVEKSQRRHSSIAYKTS
SPVPQESDVSPSVNASPSLRAERRQSSITYISSRDVNGVVSPSPPSSFNTRRPQSYSHAP
RDSRRQSSISYIAPGENSPESPLGRPGYKRGMSESGNGVFELERASGQGESTSKRQSLSS
VASGASRGPLTLTEQHADLLRSIAQHESRRMELKGQLETCEADLGKLKRQWERIVQRGIS
PNSTFHNPSPADTSGAVLGGIREGVQEVGRMLAMGLADLSSPAMPITPRHATRESDSSAS
SAETAFSTFGFNDGRGSSEWGEELSPKDGQFKPSPQIPVENLPAKVTRRRSVKGSGDLTS
RSGQHAASSSTSSAIDPSIRVPASPVLSSAVPEPDETHPSAKPEGLHIDTASPKSKRNSL
AMSGLPPPSPMPGLNSLTVVGSSTPMSSWAGSIGKRWGELTNGGSSKHGQKRGSSLFSDV
LFSDVSQSLANAFGPASPSPATQLAIPGARTGTSSSSRSHGHSHSKTMPSPAPSSRSFLD
DDDDEGQALNVGSVLIPDSAPSVKSRSSGPKTVTPNAETDFDDDWNW
Download sequence
Identical sequences XP_007772581.1.51617 jgi|Conpu1|168152|estExt_Genemark1.C_120158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]