SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|168316|estExt_Genemark1.C_120368 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|168316|estExt_Genemark1.C_120368
Domain Number - Region: 89-149
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000134
Family Class I glutamine amidotransferases (GAT) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|168316|estExt_Genemark1.C_120368
Sequence length 406
Sequence
MAANQRLPPPPPSSLRIALLSCGEPSTSSAFIAQHGDLCQRLETFLQRTAPVGLGAVPFV
SQVYDVTQMVYPTSPGISGTDNVQVEGGIEVFDAIVVAGSTSRPYDDEEWILEVVEYLQR
VMAECPDLKLIGIGIGHYIVGATFGTLPDPGSSLITSCENGSSSEKRTDWEPRKRIHQLI
SSAVFSVRLAARLRLLGERKRSQAPVLGVWGRSESAVNRGMISLRAADILSSSTSSSLPG
GASTLTLSSSGDDLNKVNAAERGDSSPEASASPLNSGNANDIAISNAYAGIFTCQGHPEL
ATETARALVDALEGNDVISAKAAEDHRLRESLNEDGERWEDGDGDEVGQVIWRVLLGKDV
VVKGEGRERGTRSWGDTYCRRARAIVAFVTMMTGVVWYVQINRTGF
Download sequence
Identical sequences jgi|Conpu1|168316|estExt_Genemark1.C_120368 XP_007772754.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]