SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|168546|estExt_Genemark1.C_130214 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|168546|estExt_Genemark1.C_130214
Domain Number 1 Region: 794-905
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000471
Family Myosin rod fragments 0.0053
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|168546|estExt_Genemark1.C_130214
Domain Number - Region: 466-548
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|168546|estExt_Genemark1.C_130214
Sequence length 1175
Sequence
MTRDYCLRFFFFRPSVFYCPHRPHPHAGIILALLAAFTAAAPALAPPATLLGTGVRSLLV
LATLDSNVAFPFAFSLPSPPPSPALNVDTMPTLARLRAAAPCAADAPERLTGGADASEGE
ASTRRLFPKKVKSNLHLQTDIHGSSSSSLKFNASLSTTGSSSTSLQSSAEPRESVESIAS
PISPAESMTAQFSNNQFHSSVRSILRDPKTPGSGQNVRFFARQGSKTPSATSADNSAASD
PSYFSLGSRARSRTPVMELFSPPNEGRSQDAQRPSNPPQADNSNIFDMSQNDVPAIPHAP
EDPVQLEEPANSDEHKQPFTSTPARALLDGIKEPSVFSPPLPAQDEKQKFSSLSRSRAMS
DSVFSRLARVASSHPLVEVDNDDTQTLANVRYGARTPPPLAPPPGDPSSPPDPFRANANT
YYTPGSNVPPTPPHALQRHTSNPSGSSSSTHSRSDSGSSSASNVHSQIISLRTQLTLHQS
LVAQYEVDLAARDEIVHSLQSSLSSAQGKLSDADKRRQQVRAWRKRVAELERVVRGLEGE
VERSREESFERSIMDEASAGALRALQTRISELERERETSWRVSGASSSDASASASASTGR
RSVLSTSDAHTDTREVEELLTVLAAKDEEIARLRSQTLEQTAEVTDMISSSVYADARSRS
RSVESLHPLNSSAETELEHARAELDAARRELARLQDERESLHHDFSAVQRAHDALTHEHG
MLRAELEAQWAHTEQMGAQIAGLRGERDAALGEKDAFAAANEALAQKKSVLAAEVEALRA
ASGDSAELARRNGELEELRVVLEARILEIEEGWVTSQNERLHLESERDELTKQLEDAHSQ
IDDLTTALQDHSEKLSDLESEKLMLLNNYAHIESTVDERNTEISTLQTRVRNTESEAESL
RAQLSAVSREHTRVADEQSRQIAELAARESGVRAQLEALLRTGAEKEGQEGEELGRARRR
VRELEKASADREFEVIQLQRANQKCKEDAEGMNIALDSKQQELELLKRRMGVRGTAGTTP
APAKIASRRESFAPSSVASTPFIRPGSAMSTTSETPSVRAGALATSKRVNGALAAAAATK
GSTAAKRSTAPTRASQAQAQAATAAVQRSTGAGPRAKSPGVGVGTSAGAASRRVSFEPNA
SSDEFALERMERRFLRALGFLVGDSRPSGDETLPL
Download sequence
Identical sequences jgi|Conpu1|168546|estExt_Genemark1.C_130214 XP_007773119.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]