SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|169509|estExt_Genemark1.C_170026 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|169509|estExt_Genemark1.C_170026
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000109
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|169509|estExt_Genemark1.C_170026
Domain Number - Region: 217-266
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|169509|estExt_Genemark1.C_170026
Sequence length 484
Sequence
MDGGNGPIIECPICLGEQSLASVLSLKCGHCICASCVSQWVQTKIQNRECRKTAVPCPAC
REPFNAERDPRPVFFNLSSSSDSNPRSPKRRRISADSDTIDLTGDAGPSSTDARERHARQ
VQDLQSRIHKLETKLGLARNGAKDLEQQLREIAISLGIEQRQRANEVTTLKEKLEEKRGQ
VRLAKQRQQEAEEEAKRTTARASKADQDRTSALDELRTKDEELRTWQHRVTTFKLDEKKW
KAKHKDSDREIQELRDEVTRLKGQLAAPPAAAPPDESLIVSAPDYNQLLGGASSDQGDAD
DPFGMGFGWEVEKTSVAEPSDSEDELNISSSSQPRPPSPRRLSSPGPAALENRPLPDDRR
QPPAVNFQSDWNLAHAAPQGRVKKQKHQDDGELVLGGGSRAKGTIRKVSMTKSSGSSSRA
KAKAKQTAKRPENRMEKVMGRDSKENKQLTLPYLGLADPKGKPSRNVVVATRAPIRAHAD
LRRT
Download sequence
Identical sequences jgi|Conpu1|169509|estExt_Genemark1.C_170026 XP_007774514.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]