SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|169590|estExt_Genemark1.C_170131 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|169590|estExt_Genemark1.C_170131
Domain Number 1 Region: 151-365
Classification Level Classification E-value
Superfamily RNI-like 0.000000432
Family 28-residue LRR 0.072
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|169590|estExt_Genemark1.C_170131
Domain Number - Region: 704-843
Classification Level Classification E-value
Superfamily RNI-like 0.011
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number - Region: 51-162
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0114
Family Biotin dependent carboxylase carboxyltransferase domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|169590|estExt_Genemark1.C_170131
Sequence length 960
Sequence
MTGVLELHTKFLAEFPEAWMRVLQGAQLVKPDDTGKGQGGPMPNWPRSSLFNFTYNIPVF
FLVNITGFSAEALDMSRRTVEQLLHFATLGLLQISPRTPAFRLAMGPPRNTRSQPSLAQA
GSRLCTLSPETLVRIMSFEIQCPYARKKNINIWIHVCKYLRSIALSAPQLWSYLSHRTTS
DLGLLQVILSHSESALLDVGIEMLSPSSMKPELVGALEGILRNASRLRSLYLKGSQAVLS
CHRHLLVNPSPYLQSLSLQFEPARDGEDDEDEEDVQDWSEEEDSTPGFYLDYELFDGKLP
SLRRLSLKNCSVKWDSSIFALRLAHNLELLTLSHCLPSSSTIPAYDSIPDNEKVKLPHLK
VLDVHEQSYEELAHFAAHLNLPIDTRWRIRVSYDYKNDSEDDMPVVPTEGPVLPPWLSTQ
PFTSSSPSRSLVLNRYEDPDEVAFTLSMYDHSLEGPEWYDPWSSREDEKLQASFIWPFSK
EGTDGLVRHLHHQWPLSDVHTLKLVGDLEDSPDSESGSTDPSFWAGLLRNAPSVRRLSIG
SGFREDGLRKVFSALMPTSQSGASVVTPLPHLTDIHINLFSDIENVEPSRVREVLAAHRL
EGLYVTGSDEVLSLWSVVSADEAVGRRLKDVSFRRLDLRWPWAGNRREGLLDLRRGPTSS
LVIRHMISRQSLDSAKTIADRFMHIPWNSLSHITFDVRIAENLHSLYDALLRDIASFQTP
CLKSLVVHAGIMRESSLYRQLAEPPFDIIQLPHLEALEIFINRTEQICINFVHSLRLPSL
RHLSICQATPSEELQFKARPPFVSLGKILHGQASLTTLRLNDRFLDVDDLLMVLRENPIT
HLELAMFTRYNEVLRQAIHAEWSVKTLTIRMAVAFEVDTIGQAVKLRLEREKEIRERPTL
ERVVVGRCRDDLSIRDKDDYPVHFGVPEDANLSQATDCAVLWYFDEATHNMADRLKVLRR
Download sequence
Identical sequences XP_007774609.1.51617 jgi|Conpu1|169590|estExt_Genemark1.C_170131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]