SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|169771|estExt_Genemark1.C_180092 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|169771|estExt_Genemark1.C_180092
Domain Number 1 Region: 17-103,133-139,252-283
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-23
Family VPS36 N-terminal domain-like 0.0099
Further Details:      
 
Domain Number 2 Region: 441-543
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000558
Family Vacuolar sorting protein domain 0.044
Further Details:      
 
Domain Number 3 Region: 203-225
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000243
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|169771|estExt_Genemark1.C_180092
Domain Number - Region: 131-164
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0126
Family Ran binding protein zinc finger-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|169771|estExt_Genemark1.C_180092
Sequence length 635
Sequence
MALRRYTTSIDGTIPAPALVYSDEEVLASQDNVGIYDGLQKAPDHQNGTIHVTSHRLFFV
HASRPHALSFAMDLAHIVRTESYSGLFSSSPKVTLILDPDTAYDDITSISASTSTLDIAG
NVGVSDQVNFASWTCEVCNHRNPPGLSPTAAKVCALCGVPRSAVPSSSSISSSLPSSSSL
PTSVLSTRTATPDIPVKGTTSEITCPACTFLNVPSRTMCEICGTPLPISTAGASAKSAPV
SRPVTPSGGGPNANESLIKISFRKGGDKAFYAILRRSLKAQAWEGRRIGAGTPKGGPGSG
QGTTMAGGTADTGAPRRLGIGIDAILRNVETSAQNTEDDLNDAFKDLDALMIKAKDLVQL
AEELNEKLTTSSSTTTEKFRTDTVPSFVSSAASSTVSAGSSRYEQFTATTLVPSTEPEEA
TFIRSSLSQLGLQMANAPITADMIKDERRWVEELARELAQVLQGSPNDFGRSRPGKAGPG
SGVGIMKRRGIVALDEVWGGWNRARGVSLIPPSTFLQALPHLVTYTSPPIQTRTFKSGLM
ALHTPPYTHTAFAARLAGYLTIFDGMNTPQVAEEEGVAVGLAAEMVDAVEQDGTICRDDL
ACAIVGGGAGGAGGAGVDVRWVMNEWEGYQWDGQE
Download sequence
Identical sequences XP_007774899.1.51617 jgi|Conpu1|169771|estExt_Genemark1.C_180092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]