SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|170224|estExt_Genemark1.C_210040 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|170224|estExt_Genemark1.C_210040
Domain Number 1 Region: 8-232
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 9.16e-21
Family DJ-1/PfpI 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|170224|estExt_Genemark1.C_210040
Sequence length 234
Sequence
MSEQKHPRVLCLPYPHFDNLDLNGPLEVLAGAEWDIVVAAADEFTQVGHGYSLRRSITYA
EALATLDSFAALLIPGAAPDAILPYLKEGETHFDGLLDVAEAFTKLGPAEDGTERVMLTV
CTGSLVPAYRGLFDGLRATTHFMAYDLLTEVSEGYRKRNPGAAKGVTLVGPVEGKEPRGR
WVDAGRNAHGVRVISAGGVSCGIDATLFIVSERYGRDKALKIAEIMEYAWRENV
Download sequence
Identical sequences R7SGN6
jgi|Conpu1|170224|estExt_Genemark1.C_210040 XP_007775566.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]