SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|18291|gw1.12.117.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|18291|gw1.12.117.1
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000108
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00218
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 78-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00229
Family Classic zinc finger, C2H2 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|18291|gw1.12.117.1
Sequence length 129
Sequence
YECDYCNKRFMTPEARSQHINHKHPTVEFPQCNSVFWTVEARDQHAYDKHPSFECARCGR
AFRTPEARDQHATDTHPTFECIHCDKVFRTAEARDQHTVDTHPTFECVRCDKVFWTAEAR
DQHASDKHR
Download sequence
Identical sequences XP_007772344.1.51617 jgi|Conpu1|18291|gw1.12.117.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]