SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|19195|gw1.3.285.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|19195|gw1.3.285.1
Domain Number 1 Region: 9-148
Classification Level Classification E-value
Superfamily PIN domain-like 5.89e-28
Family 5' to 3' exonuclease catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 133-175,221-240
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.0000143
Family 5' to 3' exonuclease, C-terminal subdomain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|19195|gw1.3.285.1
Sequence length 242
Sequence
VCPVFRHNHANAGQNPELRALLGKLGCLVRLPVLPHFVFDGADRPKVKRGKTVERNVPHY
LTNGFCSLIKAFGFTYLWAPGEAEAELAAMNKYTVVDAVMTNDSDAFVFGTRRLVRQLVK
VYTVGRIQEKTGLSNDALLLIALVRGGDYDTVGLKGAGIELAYEIASHTSLAEKLGAMIR
GESFDRFADSLAGWRNEFREVLSLNRLGVLSRRHPHVASDISEAFPSFNVLRSYVSPQTS
WS
Download sequence
Identical sequences jgi|Conpu1|19195|gw1.3.285.1 XP_007765214.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]