SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|44846|e_gw1.1.2753.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|44846|e_gw1.1.2753.1
Domain Number 1 Region: 230-370
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 8.63e-56
Family P-domain of calnexin/calreticulin 0.000000508
Further Details:      
 
Domain Number 2 Region: 26-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-47
Family Calnexin/calreticulin 0.000011
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|44846|e_gw1.1.2753.1
Domain Number - Region: 374-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0076
Family Calnexin/calreticulin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|44846|e_gw1.1.2753.1
Sequence length 541
Sequence
MRSVAFPVLIVVAASGALAADEAKPPTEIKAPFIEQFTDDWAERWTPSEATKKTPVGGET
FSYVGKWEVEAPESGLVEGAQGLVAKTKAAHHAISAPFSTPVDFTKEPLVVQYEVKYQKG
GNCGGGYLKLLEDGFQTSGKEFSDNTPWVVMFGPDLTCPGSKVIHFIFRHKNPVTGEVEE
KHLKAPPKPSLNKDTNLYTLVVHPNNQTFEVQFNHDVQLSGSLLEDFTPPVNPPKEIDDP
EDTKPADWVDTKRIPDPDAVKPSDWDEEEPYEIPDEDAEKPEGWLDDEPEEIPDPDAEKP
EEWDDEEDGDWIAPTVANPKCLEAPGCGEWKRPTKANPAYKGKWYAPMIDNPAYIGEWAP
RKIPNPGYFEDLEPVQSLSKIGGIGIELWTMTEDILFSNVYVGHSVEDALALAAETYDIT
HTAEAAASAKALDVDDDVVSFSEDPVTFVRGRVLNFVEIAKVDPVAAFKAMPETGIALAG
AIFTLFGMIGVLFGLVGAQQKPVTKKTDAPTSDDKKKADSTPVAPAGGDKKDESGGARKR
K
Download sequence
Identical sequences XP_007762474.1.51617 jgi|Conpu1|44846|e_gw1.1.2753.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]