SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|45476|e_gw1.1.4.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|45476|e_gw1.1.4.1
Domain Number 1 Region: 78-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000168
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 2 Region: 114-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000586
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|45476|e_gw1.1.4.1
Sequence length 144
Sequence
MQLGGNARKAYSPASSISSQTASPPSPETSASQRPRRNSRTLPVPIPVPNLTKKSRGRRV
PTVSNGGIWREHSRQGGEHAGARSFTCDVPGCGKCFARGEHLKRHVRSIHTNEKPHKCPH
PGCDKEFSRHDNLGQHLKTHKGGR
Download sequence
Identical sequences XP_007762525.1.51617 jgi|Conpu1|45476|e_gw1.1.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]