SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|49136|e_gw1.2.2308.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|49136|e_gw1.2.2308.1
Domain Number 1 Region: 6-51
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000406
Family AN1-like Zinc finger 0.0032
Further Details:      
 
Domain Number 2 Region: 59-115
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000106
Family AN1-like Zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|49136|e_gw1.2.2308.1
Sequence length 222
Sequence
MDSDPASVGTHCSVPSCNTLDFLPIRCRCDRNFCTIHAPADVHQCTFVWHSAPDPESSIK
RERCAAPSCNKPTLGSSGPHGGELSSGASNSCRLSFCVDHRHPDTHSCSALAAPQKLAQE
KEVSIHVKHHTSASAANARLPPSVTRSSSKLSSDPKKAAMIRKVALMKLRHRAVPADPKD
SASTVPLDQRLHVTLKYEPIESSTQGSKADKIVWFRKASEPQ
Download sequence
Identical sequences XP_007764132.1.51617 jgi|Conpu1|49136|e_gw1.2.2308.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]