SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|53089|e_gw1.4.303.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|53089|e_gw1.4.303.1
Domain Number 1 Region: 28-175
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 7.72e-45
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 183-390
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 9.32e-45
Family Class I glutamine amidotransferases (GAT) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|53089|e_gw1.4.303.1
Sequence length 393
Sequence
MFIRSISRLPLFARGLATHASPELTSLPAVLHLKSGQSFTGRSFGAPKSIFGETVFSTSI
TSYTESMTDPSYRGQILVFTTPLIGNYGVPNNKTPIDSQDVGVLLESQGIQCTAVVVADL
AEKFSHHAAVESLSSWCHRHGVPGITGVDTRTITSLLRDQGTTLGRLAIGADASASAPEA
SEYWDPSEENLVDQVSTKTPYVLNPTGDIKIAVLDFGAKANILRSLVRRGAAVTVLPWDY
DFNKVRDQYDGLFLSNGPGDPGHCMPAAMNLRKTMEQWDKPVFGICMGHQIIGMAAGLDA
YRMTFGNRGHNQPVLALASSGSIKAGRVYVTSQNHQYALKLQDPFPQGWEPFFINCNDSS
VEGIKSTPDSGKKVWGVQFHPESAGGPLDTIEV
Download sequence
Identical sequences jgi|Conpu1|53089|e_gw1.4.303.1 XP_007766388.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]