SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|53187|e_gw1.4.1740.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|53187|e_gw1.4.1740.1
Domain Number 1 Region: 138-384,430-487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-80
Family Protein kinases, catalytic subunit 0.0000171
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|53187|e_gw1.4.1740.1
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0759
Family beta-sandwich domain of Sec23/24 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|53187|e_gw1.4.1740.1
Sequence length 506
Sequence
MVDTPNPQQQQQQQLQGQQGQGQGQQGQGGQGQGQHRRRASGFRRVRDGRDLRPYVNQQP
AGRRVDERGVFLSPLRQLTTSILETYRICNPAFRYESTHNPRRVLTKPSKPAHNDGYDNE
EYDYILYVNDLLGSEDGHNRYLILDILGQGTFGQVVKCQNMKNHEIVAVKVVKNKPAYFN
QSMMEVTILELLNNQCDPQDEHHILRLRDSFIHKNHLCLVFELLSSNLYELIKQNQFQGL
STQLVKVFTAQLLDALSVLKDARLIHCDLKPENILLKSLQSPQIKVIDFGSACHERQTVY
TYIQSRFYRSPEVILGIPYTASIDMWSLGCIAVELFLGLPLFPGTSEYNQITRIVEMLGM
PPTYMLDMGKQTKQFFDSFVDVYGQKKYRLKSLEQYSREHGTNEQPGKQYFKATTLPEIV
NQAPMPSFKSSSRQGHEVEKELNNRASFIDFCQGLLNLNPIERWSPQQARMHPFITGEKF
TKPFSVRSFFSFQCPAGAGESLPKAD
Download sequence
Identical sequences XP_007766396.1.51617 jgi|Conpu1|53187|e_gw1.4.1740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]