SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|54129|e_gw1.5.533.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|54129|e_gw1.5.533.1
Domain Number 1 Region: 307-729
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.31e-127
Family RNB domain-like 0.00000114
Further Details:      
 
Domain Number 2 Region: 50-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-30
Family Cold shock DNA-binding domain-like 0.0063
Further Details:      
 
Domain Number 3 Region: 186-205,241-321
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000129
Family Cold shock DNA-binding domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|54129|e_gw1.5.533.1
Domain Number - Region: 740-790
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000132
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number - Region: 11-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00107
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|54129|e_gw1.5.533.1
Sequence length 924
Sequence
MASFSFPNMLPNMMAANMMGLNMGGVGLVQQQQQQQQQFQSQLQQTPQRKSLFAPYLPQA
SLPPLLAAGKLVVGILRVNKRNRSDAYVATEVLDADIYICGSKDRNRALEGDIVAIELLD
VDEVWGTKKEKEEKKRKKEENSAYDFKSTAGRKDDKKKDDVEVEGQGLMLFEDEEVTDEV
KPQYAGHVVAVVERMPGQLFSGTLGLLRPSSAATKEKQEAERREREGDRGDEPRRPIERP
KIVWFKPTDKRVPLIAIPTEQAPPDFVQNSEAYANKLFVACIKRHPISSLHPFGTLAEEL
GPIGDIEVETSALLKDCNFPTEEFSESVMKCLPPTPWTIPEREFEVRKDLRQERIFTIDP
ESAKDLDDAVSVKLNDDGTYDIGVHIADVSFFVKPNTALDRDARKRATSVYLVQRAVPML
PPILSGEVCSLNAGQDRLAFSAVFTTTKDAKVVKKWFGKTIIKSAAKLSYDDAQRVIDGH
PLTDIVVTPEHEASAIEHDIKVLYDIAKQLRDTRYKNGALSLSSMRLQFKLDSEGKPVDC
WQQERNEAQSLIEEFMLLTNISVAQRVAVHLPEQALLRRHDTPLERRMNALADRARRLGI
EIDTSSAGAMMRSLEGVNNPTARKLLELLSFKATQRAKYFCAGMLDIAKYNHYALSIPLY
THFTSPIRRYADVLVHRQLESVLQGGAEPKFTMDRDAVAKVAQQCNIKKDSAKLAQEQSA
HLYLCVLVSDLTQSYGPVIRQAKVVGVLDAAFDVLIPEFGIEKRVHVDQMPIDNHVYDEH
THTLQIYWSNRDVITWLAEHSDDEHLKKVKQNAEQHATKMEVASRSVHDEHALFDEDDAE
EDEIVLGRDKKTEKQNETSKQRLLSAAKVQPTFEGLRTSPSGHKIQDIKELMTVPVIVTA
DLTKSPPVIKVYSVNPYAASKNQK
Download sequence
Identical sequences XP_007767365.1.51617 jgi|Conpu1|54129|e_gw1.5.533.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]