SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|54793|e_gw1.5.1118.1 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|54793|e_gw1.5.1118.1
Domain Number 1 Region: 154-297
Classification Level Classification E-value
Superfamily Translational machinery components 2.81e-36
Family ERF1/Dom34 middle domain-like 0.00056
Further Details:      
 
Domain Number 2 Region: 1-151
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 9.68e-33
Family Dom34/Pelota N-terminal domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 289-396
Classification Level Classification E-value
Superfamily L30e-like 2.35e-32
Family ERF1/Dom34 C-terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|54793|e_gw1.5.1118.1
Sequence length 424
Sequence
MKLIGKGVDKEGTGHVTLRPEDDEDMWHLYNLIQEGDNVRAPAIRRVQNISSTGSTESKR
VRLNLTLAVTRTEFSSSGAASTEAATSGTGAAQAGPPTSTTLHITGTVTSENPHVRMGAF
HTLDIESHRDVRIEKFQSWDSVALGRVEEACVPGRGAEVGAVVCGEGTAAFCLLSEHLTV
VAHRISVPIPRKASAPGTQQHEKAMTKFYATLFEAFIRHIPYASPSIRAIVLASPGWVRD
SVYDWMLGEASRRGDKTLARTLREKTLRIHVSSPHVHSLMEVLKSPEINSQLKETKFARE
GVVLDKFFKMLGVDEMRAWYGPDHVCLAAERGAIGTLLISDELFRASDPAIRKKYVAVTE
GIRQKGGEVVIFSSMHESGQQLNQLSGIAAILTFPLDVEVVEAEEREAKEEEERLQQARI
DGGG
Download sequence
Identical sequences jgi|Conpu1|54793|e_gw1.5.1118.1 XP_007767419.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]